PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009596031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 505aa    MW: 55710.7 Da    PI: 5.2141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009596031.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_009596031.1 39 KGPWTSAEDAILVDYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding51.52.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a+ ++ gRt++++k++w++
   XP_009596031.1  92 KGAFTPEEERRIIELHAKMGNK-WARMAADLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5923486IPR017930Myb domain
SuperFamilySSF466894.12E-3036133IPR009057Homeodomain-like
SMARTSM007173.3E-133888IPR001005SANT/Myb domain
PfamPF002496.0E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-244093IPR009057Homeodomain-like
CDDcd001677.09E-114186No hitNo description
PROSITE profilePS5129426.00387141IPR017930Myb domain
SMARTSM007174.4E-1691139IPR001005SANT/Myb domain
PfamPF002493.2E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2594140IPR009057Homeodomain-like
CDDcd001679.67E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MSMTSESDDR MTSNVGVDSP SVEEACGGGN TGGGLPLKKG PWTSAEDAIL VDYVTKHGEG  60
NWNAVQKHSG LARCGKSCRL RWANHLRPDL KKGAFTPEEE RRIIELHAKM GNKWARMAAD  120
LPGRTDNEIK NYWNTRIKRR QRAGLPVYPP DICFQAISEN KQNEELGAFS STDAQYPDFL  180
PMNNYEIPAV EFKNLEFNQQ LCPPPLLDIP SGSLLDIPAR SLLAQGLNSA YYSRSFFSTV  240
HPTKRMRGSE SEFSGLNDDS SPLKNDDSFP SYHQYQNDGF LLAQSLGFSS SYYRNLTSDH  300
HPTSLGVIPG SHAHLNGNSS SSEPSRAKKL ELPSLQSQMA SWGLSSSPLP SLESVDTLIQ  360
SPPTDQTESC NLSPRNSGLL DAVLYEAQTM RASKNNLHQE SSGDVVDNSC PDLHETGWET  420
YGDPISPLGH SAASVFSEYT PTSGSSSEEP QLVTMPGCKV KQEKFDFGPY DGKDDASNPI  480
FSRPDYLLDS NCFSPMQNYV RTIWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32341401107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754750.0EF175475.1 Solanum lycopersicum GAMYB-like2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596031.10.0PREDICTED: transcription factor GAMYB-like isoform X1
SwissprotA2WW871e-106GAM1_ORYSI; Transcription factor GAMYB
TrEMBLK4C9830.0K4C983_SOLLC; Uncharacterized protein
STRINGSolyc06g073640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-81myb domain protein 65